METT10D Recombinant Protein Antigen

Name METT10D Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-81239PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody METT10D Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene METTL16
Sequence DERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human METTL16
Supplier Page Shop