YPEL3 Recombinant Protein Antigen

Name YPEL3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-81237PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody YPEL3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene YPEL3
Sequence MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YPEL3
Supplier Page Shop