ZNF350 Recombinant Protein Antigen

Name ZNF350 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-80608PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody ZNF350 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ZNF350
Sequence FKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPASQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF350
Supplier Page Shop