UBAC1 Recombinant Protein Antigen

Name UBAC1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-81842PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody UBAC1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene UBAC1
Sequence MEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBAC1
Supplier Page Shop