C10orf88 Recombinant Protein Antigen

Name C10orf88 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83979PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody C10orf88 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C10orf88
Sequence PPAPGQDLVILKRNHNNKDENPCFLYLRCGPDGGEEIASIGILSSARNMEVYLGEEYCGTSRGKNVCTVLD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C10ORF88
Supplier Page Shop