Active human Histone H3 full length protein
| Name | Active human Histone H3 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab198757 |
| Category | Protein |
| Prices | $218.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >= 90 % by SDS-PAGE. |
| Bioactivity | Assay Conditions: ab198757 was coated onto a 96-well plate, and methylation by G9a was carried out at room temperature for 60 min. Methylated ab198757 was detected using a Chemiluminescence assay. |
| SwissProt/Accession | P84243 |
| Gene | H3F3A |
| Residue | 2 to 136 |
| Sequence | ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYL VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Supplier Page | Shop |
