CCDC140 Recombinant Protein Antigen

Name CCDC140 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-14795PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CCDC140 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CCDC140
Sequence SADLGLQRGVLKSAARTCLSEISNSTRASPESAQSTDPGRAARPRTRTLPTPHSFKIGEEAEEMKKKKERKRR
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCDC140
Supplier Page Shop