C4orf51 Recombinant Protein Antigen

Name C4orf51 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-14702PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C4orf51 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C4orf51
Sequence FPTPPNYGKYCVRPKKPAQEALINYSRRGKGVLKHLHGRCDSESKVCSSEDSEADRYSDYGWGGPSSPFN
Description A recombinant protein antigen corresponding to C4orf51
Supplier Page Shop