NETO2 Recombinant Protein Antigen

Name NETO2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84624PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody NETO2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene NETO2
Sequence SYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKA
Description A recombinant protein antigen corresponding to NETO2
Supplier Page Shop