DNAJC17 Recombinant Protein Antigen

Name DNAJC17 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84614PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody DNAJC17 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene DNAJC17
Sequence AVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMRMRQAAERQQLIARMQQEDQ
Description A recombinant protein antigen corresponding to DNAJC17
Supplier Page Shop