MRPS33 Recombinant Protein Antigen

Name MRPS33 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84517PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody MRPS33 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MRPS33
Sequence MSSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYR
Description A recombinant protein antigen corresponding to MRPS33
Supplier Page Shop