| Name | NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Recombinant Protein Antigen |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-84511PEP |
| Category | Protein |
| Prices | $209.00 |
| Sizes | 100 µl |
| Applications | B/N |
| For Antibody | NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) Antibody |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E.coli |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Gene | NFU1 |
| Sequence | RRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMD |
| Description | A recombinant protein antigen corresponding to NFU1 |
| Supplier Page | Shop |