PHF20L1 Recombinant Protein Antigen

Name PHF20L1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84501PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody PHF20L1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PHF20L1
Sequence LLADVYGVTEVLHGLQLKIGILKNKHHPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQNHKEPPRLP
Description A recombinant protein antigen corresponding to PHF20L1
Supplier Page Shop