cGK2/PRKG2 Recombinant Protein Antigen

Name cGK2/PRKG2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84497PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody cGK2/PRKG2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PRKG2
Sequence REYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVE
Description A recombinant protein antigen corresponding to PRKG2
Supplier Page Shop