CCDC11 Recombinant Protein Antigen

Name CCDC11 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83524PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CCDC11 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CFAP53
Sequence MYSQRFGTVQREVKGPTPKVVIVRSKPPKGQGAEHHLERIRRSHQKHNAILASIKSSERDRLKAEWDQHNDCKILDSLVRARIKDAVQGFIINIEERRNK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCDC11
Supplier Page Shop