C16orf78 Recombinant Protein Antigen

Name C16orf78 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82713PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C16orf78 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C16orf78
Sequence ATFIRDWSNKMPDMAYERKLKSLMEKSTEPKMETMRMLKPEEVLSCRYLRLSKENIRTLLKLCKDAGMNVDIHPHMVEEDIDAKKVFTGIPSMA
Description A recombinant protein antigen corresponding to C16ORF78
Supplier Page Shop