LRRC34 Recombinant Protein Antigen

Name LRRC34 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-49273PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody LRRC34 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene LRRC34
Sequence FDEATCIAYSDLIQMGCLKPDNTDVEPFVVDGRVYLAEVSNGLKKHYYWTSTYGESYDHSSNAGFALVPVGQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LRRC34
Supplier Page Shop