MORN4 Recombinant Protein Antigen

Name MORN4 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30713PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody MORN4 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MORN4
Sequence FNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNL
Description A recombinant protein antigen corresponding to MORN4
Supplier Page Shop