Isthmin 1, Angiogenesis Inhibitor Recombinant Protein Antigen

Name Isthmin 1, Angiogenesis Inhibitor Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30670PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody Isthmin 1, Angiogenesis Inhibitor Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ISM1
Sequence TESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNATKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSC
Description A recombinant protein antigen corresponding to ISM1
Supplier Page Shop