LRRN3/NLRR-3 Recombinant Protein Antigen

Name LRRN3/NLRR-3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30614PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody LRRN3/NLRR-3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene LRRN3
Sequence QNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNL
Description A recombinant protein antigen corresponding to LRRN3
Supplier Page Shop