DIMT1L Recombinant Protein Antigen

Name DIMT1L Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30659PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody DIMT1L Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene DIMT1
Sequence GGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCV
Description A recombinant protein antigen corresponding to DIMT1
Supplier Page Shop