C1orf226 Recombinant Protein Antigen

Name C1orf226 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30517PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C1orf226 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C1orf226
Sequence DFLRRKEPSSLGSVGVTEINKTAGAQLASGTDAAPEAWLEDERSVLQETFPRLDPPPPITRKRTPRALKTTQD
Description A recombinant protein antigen corresponding to C1orf226
Supplier Page Shop