Name | Paralemmin 3 Recombinant Protein Antigen |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP2-30529PEP |
Category | Protein |
Prices | $209.00 |
Sizes | 100 µl |
Applications | B/N |
For Antibody | Paralemmin 3 Antibody |
Species Reactivities | Human |
Nature | Recombinant |
Source | E.coli |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Gene | PALM3 |
Sequence | DPTSKDPQSPEGQAQARIRNLEDSLFTLQSQLQLLQSASTGAQHKPSGRPSWRRQGHRPLSQSIV |
Description | A recombinant protein antigen corresponding to PALM3 |
Supplier Page | Shop |