SUV420H2 Recombinant Protein Antigen

Name SUV420H2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30524PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody SUV420H2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SUV420H2
Sequence EGFFGEKNEHCECHTCERKGEGAFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSG
Description A recombinant protein antigen corresponding to SUV420H2
Supplier Page Shop