MXRA8/DICAM Recombinant Protein Antigen

Name MXRA8/DICAM Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-30499PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody MXRA8/DICAM Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MXRA8
Sequence GLYTCNLHHHYCHLYESLAVRLEVTDGPPATPAYWDGEKEVLAVARGAPALLTCVNRGHVWTDRHVEEAQQVVHWDRQ
Description A recombinant protein antigen corresponding to MXRA8
Supplier Page Shop