| Name | PPP1R1C Recombinant Protein Antigen |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30497PEP |
| Category | Protein |
| Prices | $209.00 |
| Sizes | 100 µl |
| Applications | B/N |
| For Antibody | PPP1R1C Antibody |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E.coli |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Gene | PPP1R1C |
| Sequence | PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI |
| Description | A recombinant protein antigen corresponding to PPP1R1C. Source: E.coli Amino Acid Sequence: PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI |
| Supplier Page | Shop |