C5orf52 Recombinant Protein Antigen

Name C5orf52 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-14599PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C5orf52 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C5orf52
Sequence REAAMTQPTRPSVTCDQGSSTIGGTAAQATTSSSATSGSNYQRDRLGRRPEIG
Description A recombinant protein antigen corresponding to C5orf52
Supplier Page Shop