C20orf118 Recombinant Protein Antigen

Name C20orf118 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-14595PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C20orf118 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TLDC2
Sequence EASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSK
Description A recombinant protein antigen corresponding to C20orf118
Supplier Page Shop