| Name | PKD2L2 Recombinant Protein Antigen |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-48796PEP |
| Category | Protein |
| Prices | $199.00 |
| Sizes | 100 µl |
| For Antibody | PKD2L2 Antibody |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Gene | PKD2L2 |
| Sequence | NNTCKVYSSFQSLMSECYGKYTSANEDLSNFGLQINTEWRYSTSNTNSPWHWGFLGVYRNGGYIFTLSKSKSETKNKFIDLRLNSWITR |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKD2L2 |
| Supplier Page | Shop |