MRPS18B Recombinant Protein Antigen

Name MRPS18B Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48792PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MRPS18B Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MRPS18B
Sequence GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS18B. Source: E. coli Amino Acid Sequence: GLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMP
Supplier Page Shop