ZNF248 Recombinant Protein Antigen

Name ZNF248 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-48538PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody ZNF248 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ZNF248
Sequence GQGFHDEAAFFTNKRSQIGETVCKYNECGRTFIESLKLNISQRPHLEMEPYGCSICGKSFCMNLRFG
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF248
Supplier Page Shop