TTLL2 Recombinant Protein Antigen

Name TTLL2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86766PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody TTLL2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TTLL2
Sequence QSKPKLRSRHTPHKTLMPYASLFQSHSCKTKTSPCVLSDRGKAPDPQAGNFVLVFPFNEATLGASRNGLNVKR
Description A recombinant protein antigen corresponding to TTLL2
Supplier Page Shop