PRSS35 Recombinant Protein Antigen

Name PRSS35 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86756PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody PRSS35 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PRSS35
Sequence VSDESNDLLYQYCDAESGSTGSGVYLRLKDPDKKNWKRKIIAVYSGHQWVDVHGVQKDYNVAVRITPL
Description A recombinant protein antigen corresponding to PRSS35
Supplier Page Shop