SLC35F1 Recombinant Protein Antigen

Name SLC35F1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86755PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody SLC35F1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC35F1
Sequence RVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA
Description A recombinant protein antigen corresponding to SLC35F1
Supplier Page Shop