PTRH1 Recombinant Protein Antigen

Name PTRH1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86713PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody PTRH1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PTRH1
Sequence VYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATD
Description A recombinant protein antigen corresponding to PTRH1
Supplier Page Shop