SLC26A11 Recombinant Protein Antigen

Name SLC26A11 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86346PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody SLC26A11 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC26A11
Sequence SAARPETKVSEGPVLVLQPASGLSFPAMEALREEILSRALEVSPPRCLVLECTHVCSIDYTVVLGLGELL
Description A recombinant protein antigen corresponding to SLC26A11
Supplier Page Shop