OTOP1 Recombinant Protein Antigen

Name OTOP1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86306PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody OTOP1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene OTOP1
Sequence NGVLNESKHQLNEHKEWLITLGFGNITTVLDDHTPQCNCTPPTLCTAISHGI
Description A recombinant protein antigen corresponding to OTOP1
Supplier Page Shop