KIAA1586 Recombinant Protein Antigen

Name KIAA1586 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86291PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody KIAA1586 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene KIAA1586
Sequence NKTTRQASLRKKIREHDVSKAHGKIQDLLKESTNDSICNLVHKQNNKNIDATVKVFNTVYSLVKHNRPLSDIEGARELQEKNGEVNCLNTRYSATRI
Description A recombinant protein antigen corresponding to KIAA1586
Supplier Page Shop