FANK1 Recombinant Protein Antigen

Name FANK1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86258PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody FANK1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene FANK1
Sequence GGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKG
Description A recombinant protein antigen corresponding to FANK1
Supplier Page Shop