TOM1 Recombinant Protein Antigen

Name TOM1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86170PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TOM1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TOM1
Sequence LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOM1
Supplier Page Shop