USP51 Recombinant Protein Antigen

Name USP51 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86167PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody USP51 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene USP51
Sequence LRLIYQRFVWSGTPETRKRKAKSCICHVCSTHMNRLHSCLSCVFFGCFTEKHIHKHAETKQHHLAVDLYHGVIYCFMCKDYVYDKDIEQIAKETKEKILRLLTSTSTDVSHQQFMTSGFEDKQSTCETKEQEP
Description A recombinant protein antigen corresponding to USP51
Supplier Page Shop