OSBPL10 Recombinant Protein Antigen

Name OSBPL10 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86153PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody OSBPL10 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene OSBPL10
Sequence LLLLKATSAATLSCLGECLNLLQQSVHQAGQPSQKPGASENILGWHGSKSHSTEQLKNGTLGSLPSASANITWAILPNSAEDEQTSQPEPEPNSGSELVLSEDEKSDNEDKEETELGVMEDQRSIILHLISQLKLGMD
Description A recombinant protein antigen corresponding to OSBPL10
Supplier Page Shop