FAM45A Recombinant Protein Antigen

Name FAM45A Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86232PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody FAM45A Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene FAM45A
Sequence GYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQDIA
Description A recombinant protein antigen corresponding to FAM45A. Source: E.coli Amino Acid Sequence: GYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQDIA
Supplier Page Shop