C9orf43 Recombinant Protein Antigen

Name C9orf43 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82743PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C9orf43 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C9orf43
Sequence PVLNLNETQLPCPEDVRNMVVLWIPEETEIHVSQHGKKKRKNSAVKSKSFLGLSGNQSAGTRVGTPGMIVPPPTPVQLSEQFSSDFLPLWAQSEALPQDLLKELLPGGKQTMLCP
Description A recombinant protein antigen corresponding to C9ORF43
Supplier Page Shop