C7orf62 Recombinant Protein Antigen

Name C7orf62 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82726PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C7orf62 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C7orf62
Sequence MSFSVHNQKGSKRPLPLEPLLFLQVPRSNYLHFQEEKQRLHLKKFLLHRMFLVAKIQANVERKDVADYYEQMF
Description A recombinant protein antigen corresponding to C7orf62
Supplier Page Shop