SLC7A8 Recombinant Protein Antigen

Name SLC7A8 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-49319PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SLC7A8 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC7A8
Sequence WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC7A8
Supplier Page Shop