Acylglycerol Kinase Recombinant Protein Antigen

Name Acylglycerol Kinase Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-49085PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Acylglycerol Kinase Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene AGK
Sequence IVKGETVPLDVLQIKGEKEQPVFAMTGLRWGSFRDAGVKVSKYWYLGPLKIKAAHFFSTLKEWPQTHQASISYTGPTERPPNEPEETPVQRPSLYRRILRRLASYWAQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Acylglycerol Kinase
Supplier Page Shop