CEP95 Recombinant Protein Antigen

Name CEP95 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-49042PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CEP95 Antibody
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CEP95
Sequence ALRRHDLLTTLVKKEYEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSM
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CEP95
Supplier Page Shop