FIP1/RCP Recombinant Protein Antigen

Name FIP1/RCP Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83600PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody FIP1/RCP Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene RAB11FIP1
Sequence AKESKKPESRRSSLLSLMTGKKDVAKGSEGENPLTVPGREKEGMLMGVKPGEDASGPAEDLVRRSEKDTAAVVSRQGSSLNLFEDV
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAB11FIP1
Supplier Page Shop