C12orf42 Recombinant Protein Antigen

Name C12orf42 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83566PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody C12orf42 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C12orf42
Sequence ERTQNSMACKRLLHTCQYIVPRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPKQAWNSSFLEQLVKKPNWAHSVNPVHLE
Description A recombinant protein antigen corresponding to C12ORF42
Supplier Page Shop